PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G31140.2
Common NameAGL63, alg63, F28K20.7, (goa), GOA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 215aa    MW: 25174.8 Da    PI: 9.8774
Description GORDITA
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G31140.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.96.2e-24959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 k+ie+k++rqvtf+kR++ ++KKA+ELSvLCd+   +iifs++++ly+++s
  AT1G31140.2  9 KKIEEKIKRQVTFAKRKKSLIKKAYELSVLCDVHLGLIIFSHSNRLYDFCS 59
                 68***********************************************96 PP

2K-box30.61.4e-11891571381
        K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelq 81 
                  + + + +  + + +eienL+ ++  + G +L+ L++ eL + e +Le+sl++ R++K+e++++q +++ 
  AT1G31140.2  89 QCSDCVKTKESMMREIENLKLNLQLYDGHGLNLLTYDELLSFELHLESSLQHARARKSEFMHQQQQQQT 157
                  45555566788999***********************************************99876543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-27160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.034161IPR002100Transcription factor, MADS-box
CDDcd002654.49E-35278No hitNo description
PRINTSPR004047.5E-22323IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.29E-25379IPR002100Transcription factor, MADS-box
PfamPF003195.7E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-223859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.72190178IPR002487Transcription factor, K-box
PfamPF014861.9E-695158IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030308Biological Processnegative regulation of cell growth
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048530Biological Processfruit morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009046anatomyflower
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MRKGKRVIKK IEEKIKRQVT FAKRKKSLIK KAYELSVLCD VHLGLIIFSH SNRLYDFCSN  60
STSMENLIMR YQKEKEGQTT AEHSFHSDQC SDCVKTKESM MREIENLKLN LQLYDGHGLN  120
LLTYDELLSF ELHLESSLQH ARARKSEFMH QQQQQQTDQK LKGKEKGQGS SWEQLMWQAE  180
RQMMTCQRQK DPAPANEGGV PFLRWGTTHR RSSPP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n6j_A7e-15876773Myocyte-specific enhancer factor 2B
1n6j_B7e-15876773Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT1G31140
AtGenExpressAT1G31140
Functional Description ? help Back to Top
Source Description
TAIREncodes a B-sister MADS-box protein, GORDITA which is specific to the Brassicaceae. GOA is the most closely related paralog of ABS. GOA represses fruit growth and contributes to integument development. Over-expression of GOA results in disorganized floral structure and addition of carpel-like features to sepals.
Function -- GeneRIF ? help Back to Top
  1. GOA has a role in integument development and regulating fruit growth.
    [PMID: 20088901]
  2. The knockdown phenotype of GOA suggests a role for this gene in fruit longitudinal growth, while over-expression of GOA results in disorganized floral structure and addition of carpel-like features to sepals
    [PMID: 20598091]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00172DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G31140.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G31140
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR6713670.0FR671367.1 Arabidopsis thaliana mRNA for putative MADS domain protein AGL63 (GOA), ecotype Col-0.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001185120.11e-161MADS-box protein GORDITA
TrEMBLQ9SA071e-161Q9SA07_ARATH; F28K20.7 protein
STRINGAT1G31140.21e-161(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16860910
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. De Bodt S,Raes J,Van de Peer Y,Theissen G
    And then there were many: MADS goes genomic.
    Trends Plant Sci., 2003. 8(10): p. 475-83
    [PMID:14557044]
  6. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  7. Prasad K,Zhang X,Tob
    The Arabidopsis B-sister MADS-box protein, GORDITA, represses fruit growth and contributes to integument development.
    Plant J., 2010. 62(2): p. 203-14
    [PMID:20088901]
  8. Prasad K,Ambrose BA
    Shaping up the fruit: control of fruit size by an Arabidopsis B-sister MADS-box gene.
    Plant Signal Behav, 2010. 5(7): p. 899-902
    [PMID:20484990]
  9. Erdmann R,Gramzow L,Melzer R,Theissen G,Becker A
    GORDITA (AGL63) is a young paralog of the Arabidopsis thaliana B(sister) MADS box gene ABS (TT16) that has undergone neofunctionalization.
    Plant J., 2010. 63(6): p. 914-24
    [PMID:20598091]